Recipio
Recipio

Avocado Cucumber Salad with Chili-Lime Dressing

Brighten up your summer menu with this refreshing Avocado Cucumber Salad, packed with nutrients and a zesty chili-lime dressing—perfect for quick meals or gatherings.

Recipio Team
Recipio Team
·4 min read
Share:
Avocado Cucumber Salad with Chili-Lime Dressing
Avocado Cucumber Salad with Chili-Lime Dressing

Avocado Cucumber Salad with Chili-Lime Dressing

🍽 4 servings · 🔥 150 kcal

A fresh and vibrant summer salad that combines creamy avocado, crisp cucumbers, and a zesty chili-lime dressing.

View Full Recipe →

Whip up a vibrant and nutritious Avocado Cucumber Salad with Chili-Lime Dressing for a quick and tasty addition to your summer meals.

Why You'll Love This Avocado Cucumber Salad

  • Fresh and Zesty: The salad is a perfect balance of creamy avocado, crunchy cucumber, and zesty lime dressing.
  • Nutrient-Rich: Packed with vitamins K, A, E, and C, as well as healthy fats from avocados.
  • Easily Portable: Enjoy it on the go or make a batch for an easy lunch option.

Key Ingredients & Why They Matter

  • Pieces of Mini Cucumbers: Add a crisp, refreshing crunch that complements the creamy avocados.
  • Pieces of Avocados: Provide healthy fats and essential vitamins, keeping you full longer.
  • Stalks of Green Onion: Bring a subtle onion flavor to brighten the salad's taste profile.
  • Cup of Fresh Cilantro: Offers a fresh, herbaceous note that enhances the overall dish.

How to Make Avocado Cucumber Salad Step by Step

  1. 10 Minutes Prep: Start by washing and slicing your mini cucumbers into thin rounds. Halve the avocados, remove the pits, and slice them into small pieces.
  2. Cut the green onions into small pieces, discarding any tough white roots.
  3. In a mixing bowl, combine the sliced cucumbers, avocado, and green onion.
  4. Whisk together olive oil, fresh lime juice, red pepper flakes, salt, and a pinch of sugar to taste for the dressing. Pour over the salad ingredients, toss gently until evenly coated.

Tips, Substitutions & Variations

  • Substitute Lime: Use lemon juice if you don't have lime available.
  • Variation Idea: Add crumbled feta cheese for a tangy twist or roasted red peppers for a smoky flavor.
  • Cooking Time: Serves 4 immediately, can be stored in the fridge for up to 2 days.

Serving Suggestions

Storage & Meal Prep

This salad is best enjoyed fresh, but leftovers can be stored in an airtight container in the refrigerator for up to 2 days. For longer storage, keep it refrigerated and consume within 3-4 days.

Frequently Asked Questions

Can I make this salad ahead of time?

This salad is best served fresh, but you can prepare the dressing a day in advance to mix with the ingredients just before serving. This helps keep the avocado from browning too quickly.

Is there a vegan alternative for sugar in the dressing?

You can omit the sugar or use an all-fruit spread like agave nectar as a natural sweetener, if desired.

Can I freeze this salad?

While freezing is not recommended due to potential loss of texture and flavor, you can blend the ingredients into a smooth avocado sauce and freeze it in ice cube trays for later use. Thaw and reconstitute as needed.

Enjoy the refreshing flavors of this Avocado Cucumber Salad with Chili-Lime Dressing, perfect for any occasion or meal prep session! Save this recipe in Recipio to find more of our favorite quick and easy dishes.

More Recipes You'll Love

Southern Potato Salad

Southern Potato Salad

⏱ 30 min · 🍽 4 servings · 🔥 460 kcal

This Southern potato salad with warm potatoes, hard boiled eggs, crunchy celery, mayo, sweet pickle, and mustard is creamy, tangy, and delicious.

View Full Recipe →

Homemade Oreo Icecream

🍽 2 servings · 🔥 330 kcal

A delicious and healthy homemade Oreo ice cream using Greek yogurt and whey protein.

View Full Recipe →
Chicken Makhani (Indian Butter Chicken)

Chicken Makhani (Indian Butter Chicken)

⏱ 25 min · 🍽 4 servings · 🔥 408 kcal

This butter chicken recipe, or chicken makhani, is a favorite Indian dish that features a full-flavored sauce with spices that complement chicken.

View Full Recipe →
No Sour Cream Beef Stroganoff

No Sour Cream Beef Stroganoff

⏱ 20 min · 🍽 4 servings · 🔥 618 kcal

This Stroganoff recipe substitutes sour cream with condensed soup, wine, flour, and broth for a rich mushroom sauce packed with savory ground beef.

View Full Recipe →
avocadocucumbersaladchililimedressingsummersaladhealthysaladeasyrecipesveganquickmealsrefreshingdishes
Share:
No ratings yet

Rate this post

💬

Community Reviews

🔥 Try This Recipe
Avocado Cucumber Salad with Chili-Lime Dressing
New

Avocado Cucumber Salad with Chili-Lime Dressing

A fresh and vibrant summer salad that combines creamy avocado, crisp cucumbers, and a zesty chili-lime dressing.

🔥 150 kcal🍽 4 servings
View Recipe
🍳

Get Cooking Tips!

Join our newsletter list for free weekly recipes and kitchen guides.

Advertisement
Google AdSense
300 × 250 Medium Rectangle
Advertisement
Google AdSense
300 × 600 Half Page